PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_48006g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 234aa    MW: 26061.2 Da    PI: 8.6971
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_48006g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.82.8e-141663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l+  ++ +G g W++ ++  g++ ++k+c+ rw +yl
    MA_48006g0010 16 KGAWTQEEDARLIAHIRTHGEGGWSSLPKAAGLRHCRKSCRFRWKNYL 63
                     79********************************************97 PP

2Myb_DNA-binding50.93.7e-1669113147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++++ Edel+++++ +lG++ W++Ia +++ gRt++++k++w ++
    MA_48006g0010  69 RGNFSEGEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWSTH 113
                      89********************.*********.***********876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.141163IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-191166IPR009057Homeodomain-like
SMARTSM007175.1E-111565IPR001005SANT/Myb domain
SuperFamilySSF466896.74E-2715110IPR009057Homeodomain-like
PfamPF002491.0E-121663IPR001005SANT/Myb domain
CDDcd001676.72E-101863No hitNo description
PROSITE profilePS5129427.03664118IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2567118IPR009057Homeodomain-like
SMARTSM007176.3E-1568116IPR001005SANT/Myb domain
PfamPF002492.0E-1469113IPR001005SANT/Myb domain
CDDcd001677.65E-1171114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MGKSSCCEES QAHTNKGAWT QEEDARLIAH IRTHGEGGWS SLPKAAGLRH CRKSCRFRWK  60
NYLRPDLKRG NFSEGEDELI IKLHSLLGNK WSLIAGRLPG RTDNEIKNYW STHIKRKVLS  120
RGLDPQTHRP LCPPHNSKTT RNSPPAPEQE IPAFQSTRTV EIADFFQHDR SESSPIKPAA  180
SKDEEHPGLN LDLCLSLPSN SAPADNRASS VDRTMVSVQG SDCSTLGTLQ YIVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-281511826128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010028718.15e-82PREDICTED: myb-related protein 308-like
SwissprotP813931e-76MYB08_ANTMA; Myb-related protein 308
SwissprotQ9SZP12e-76MYB4_ARATH; Transcription repressor MYB4
TrEMBLA9NYS61e-115A9NYS6_PICSI; Putative uncharacterized protein
STRINGBra010736.1-P5e-78(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.19e-78myb domain protein 4